PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00024342001
Common NameGSBRNA2T00024342001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 199aa    MW: 21381.4 Da    PI: 8.2776
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00024342001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.92.2e-40201191100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++C+++pyf   +p kfa vhk+FGasnv+k+l ++pe +r da++slvyeA++r+rdPvyG++g i++lqqq++ l
  GSBRNA2T00024342001  20 PCAACKLLRRRCAQECPFSPYFSPCEPLKFASVHKVFGASNVSKMLMEVPEGQRADAANSLVYEANVRLRDPVYGCMGAISALQQQVQAL 109
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +ael ++++e
  GSBRNA2T00024342001 110 QAELTAVRSE 119
                          *****99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.13319120IPR004883Lateral organ boundaries, LOB
PfamPF031951.3E-4020117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MAGIRRHISG PPGALNTITP CAACKLLRRR CAQECPFSPY FSPCEPLKFA SVHKVFGASN  60
VSKMLMEVPE GQRADAANSL VYEANVRLRD PVYGCMGAIS ALQQQVQALQ AELTAVRSEI  120
LKYKQREAVA TLIVPSNSQY HNSGGVSVIA LPPQTPSTPP QPTAAHHPPP PSSCVYSQPT  180
TRALEYGEIE SENNSYFG*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00024342001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4466131e-161DQ446613.1 Arabidopsis thaliana clone pENTR221-At2g40470 LOB domain protein 15/lateral organ boundaries domain protein 15 (At2g40470) mRNA, complete cds.
GenBankDQ6530511e-161DQ653051.1 Arabidopsis thaliana clone 0000012791_0000009246 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013691246.11e-145PREDICTED: LOB domain-containing protein 15-like
SwissprotQ8L5T51e-102LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A078GGX91e-145A0A078GGX9_BRANA; BnaC04g01340D protein
STRINGBra004572.1-P1e-141(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM19272781
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.17e-95LOB domain-containing protein 15
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]